PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl016389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family M-type_MADS
Protein Properties Length: 168aa    MW: 19595.5 Da    PI: 10.0857
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S40909697PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.51.7e-1367105543
                SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
     SRF-TF   5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 
                 ++ r+  f kR++g+ KK +ELS+LC++e++++ f+++
  Pgl016389  67 RDTSRNMRFMKRKKGLEKKVKELSILCGVEACMVCFGPQ 105
                67889999****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.1755103IPR002100Transcription factor, MADS-box
SMARTSM004329.1E-1355114IPR002100Transcription factor, MADS-box
CDDcd002669.14E-2056145No hitNo description
SuperFamilySSF554556.02E-2156155IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-85777IPR002100Transcription factor, MADS-box
PfamPF003193.6E-1467105IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-87792IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-892113IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
XAEMRLAVRD GMSYIAAGMF SSETVPDQRN VQLLSEIDLF ERLHIAEVNF LARKMGRAKI  60
PIKWIPRDTS RNMRFMKRKK GLEKKVKELS ILCGVEACMV CFGPQMDQQT TSDHHDVWPG  120
KSKALEIVER YRNLSKEEQD KKKLDNTSFL EQRIKNIQDF ETLKKQKS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB2ZX889e-52B2ZX88_CRYJA; Type I MADS-box transcription factor
TrEMBLD5AE408e-53D5AE40_PICSI; Putative uncharacterized protein